RTL10 antibody orb614134 from Biorbyt

Product Specs
ItemRTL10 antibody
CompanyBiorbyt
Price Pricing Info Supplier Page
Catalog Numberorb614134
Quantity10 µg, 100 µg
ClonalityPolyclonal
ReactivityHuman, Mouse, Rat
ApplicationsFC, WB
TargetRTL10
IsotypeRabbit IgG
Conjugate/TagUnconjugated
NCBI Full Gene Nameretrotransposon Gag like 10
ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 µg/ml
StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles
HostRabbit
NCBI Gene AliasesBOP, C22orf29
ImmunogenA synthetic peptide corresponding to a sequence of human RTL10 (EILRRLTGRAQAWAAPYLDGDLPLPDDYELFCQDLKEVVQD)
FormatLyophilized

Specifications/Features

Application Notes: Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Application Dilutions: Western blot, 0.25-0.5µg/ml, Human, Mouse, Rat Flow Cytometry, 1-3µg/1x106 cells, Human

Add to Compare List